This is the
talk page for discussing improvements to the
Docking (molecular) article. This is not a forum for general discussion of the article's subject. |
Article policies
|
Find sources: Google ( books · news · scholar · free images · WP refs) · FENS · JSTOR · TWL |
![]() | This article is rated B-class on Wikipedia's
content assessment scale. It is of interest to the following WikiProjects: | ||||||||||||||||
|
Dear all,
I tried to add the following external link to this page:
I think this link makes sense here:
However, the link seems to have been removed (automatically?).
Would it be possible to reconsider this link, and eventually let it in this page in the section "external link"?
Thank you for your help, Vincent —Preceding unsigned comment added by Vzoete ( talk • contribs) 08:01, 7 June 2010 (UTC)
-- Dockingman 19:17, 30 April 2006 (UTC)
The use of penicillins will soon be obsolete as bacteria continue to evolve beta-lactamases that confer resistance to nearly every penicillin derivative that has been found to be active. Most betalactamases are susceptible to inhibition by clavulanic acid, and the metallobetalactamases, which are not, are rare. Changes to PBP targets causes serious resistance (eg in MRSA) which is not mediated by betalactamses at all. -- ben 09:52, 25 June 2006 (UTC)
The list on external links is very much a commercial listing... should it be trimmed/modified?
I found this article very confusing since it stated that the purpose of docking is to predict whether a molecule will bind. However this is not correct. The purpose of docking is to determine (1) the best relative orientation between two molecules in a complex and (2) the conformation of each molecule in the complex. Given this orientation, it is then the job of the scoring function to determine whether the interaction between these two molecules will be favorable. Therefore I have done a major rewrite of several of the sections to make this distinction clearer. Boghog2 23:25, 20 October 2007 (UTC)
The free energy link points to a disambiguation page. I assume this should link to the "Free energy perturbation" page, but I'm not sure. I suggest to have the link pointing to the right page, not a disambiguation page. Hedgehawk ( talk) 22:08, 15 September 2008 (UTC)
Here is an article that goes into some detail on protein-ligand docking: searching the conformational space for docking. The article's name is clearly not a good one - but I don't know whether it should be renamed, or merged with this article instead. (If kept, it also needs to be sourced and wikified.) What do people think? Lfh ( talk) 19:15, 10 May 2010 (UTC)
MQQDAHRVSTPVEADSDTDNASIYADTLDNASYTTSVTSSVLDYQYENGRRYHSYHEGEYVLPNDEQEQDRLDLSHHIYLMLLKGELFQAPINNPKRVLDLGTGTGLWAIEYAEYVFFPPKISIKSTPNKQSSTNPNSQVIGIDLSAIQPSWVPPNCRFEIDDFEQPWSYSKPFDYIHGRELEGSIRDHDRLFKQALDNLNPNGWFEISSFDVNTYSDDGTHLGATNLLLSIKHMHESSRMFGKDTTSSPSWKDRMKKAGFVNVKEDVLKLPQSPWPKDPKLKELGRYHQLNMLEAMPIYTYVLFSRVLGWTRAEIEGLLAGIRMELRDTSYRLYTKVRVVYGQKPGGPVSA — Preceding unsigned comment added by 106.88.180.95 ( talk) 01:37, 5 April 2015 (UTC)
I feel that it is reasonable to move/copy the list of protein-ligand docking software list to a new page of its own, similar to other lists of structure determination. Available at List of protein-ligand docking software. Vivek Rai ( talk) 12:39, 11 January 2016 (UTC)
Hello fellow Wikipedians,
I have just modified 11 external links on Docking (molecular). Please take a moment to review my edit. If you have any questions, or need the bot to ignore the links, or the page altogether, please visit this simple FaQ for additional information. I made the following changes:
{{
dead link}}
tag to
http://bcb.med.usherbrooke.ca/FlexAIDWhen you have finished reviewing my changes, please set the checked parameter below to true or failed to let others know (documentation at {{
Sourcecheck}}
).
This message was posted before February 2018.
After February 2018, "External links modified" talk page sections are no longer generated or monitored by InternetArchiveBot. No special action is required regarding these talk page notices, other than
regular verification using the archive tool instructions below. Editors
have permission to delete these "External links modified" talk page sections if they want to de-clutter talk pages, but see the
RfC before doing mass systematic removals. This message is updated dynamically through the template {{
source check}}
(last update: 5 June 2024).
Cheers.— InternetArchiveBot ( Report bug) 13:01, 14 December 2016 (UTC)
VIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNPMYVSDTVTFVNVATCAQGVSRSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEAGTTKAGYPYNYNTTASDQILIENAAGHRVCISTYTTNLGSGPVSISAVGVLAPHSALAVLEDTVDYPARAHTFDDFC